PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_07584.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 379aa    MW: 42483.1 Da    PI: 8.5473
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_07584.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.52.2e-56681941129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeel+++yL+kkv + ++++ ++i evd++k+ePw+Lp ++k +ekewyfF+ rd+ky+tg r+nrat++gyWkat
  Rsa1.0_07584.1_g00001.1  68 LPPGFRFHPTDEELISHYLHKKVLDISFSA-KAIGEVDLNKSEPWELPWMAKMGEKEWYFFCVRDRKYPTGLRTNRATEAGYWKAT 152
                              79**************************99.88***************8888899******************************* PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              gkdke+++ +++lvg+kktLvfy+grapkg+kt+Wvmheyrle
  Rsa1.0_07584.1_g00001.1 153 GKDKEIYR-GKSLVGMKKTLVFYRGRAPKGQKTNWVMHEYRLE 194
                              ********.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.29E-6564218IPR003441NAC domain
PROSITE profilePS5100560.16168218IPR003441NAC domain
PfamPF023651.1E-2969193IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MQLHISPSMR SSPASSTSAM TSSPATPSSS PALFSSAADL SPPSNCFLKG QKMETFCGFQ  60
KEEEQMDLPP GFRFHPTDEE LISHYLHKKV LDISFSAKAI GEVDLNKSEP WELPWMAKMG  120
EKEWYFFCVR DRKYPTGLRT NRATEAGYWK ATGKDKEIYR GKSLVGMKKT LVFYRGRAPK  180
GQKTNWVMHE YRLEGKLSAH NLPKTAKNEW VICRVFQKSA GGKKIPISSL IRIGTLGTDF  240
SPSLMPSLTD ASPFNDKTKT EPVYVPCFSN QTDQAQGNTL NCFSSPDIFH RIPLYQTQSL  300
QVSGNLQSPI LGQEHSVLHA VIDNNRRQNL KVMSVSQETA VSTDMNTDIS SDFEYGKRHA  360
QEDPSSSAGP VDLEPFWNY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-556522414171NO APICAL MERISTEM PROTEIN
1ut4_B7e-556522414171NO APICAL MERISTEM PROTEIN
1ut7_A7e-556522414171NO APICAL MERISTEM PROTEIN
1ut7_B7e-556522414171NO APICAL MERISTEM PROTEIN
3swm_A7e-556522417174NAC domain-containing protein 19
3swm_B7e-556522417174NAC domain-containing protein 19
3swm_C7e-556522417174NAC domain-containing protein 19
3swm_D7e-556522417174NAC domain-containing protein 19
3swp_A7e-556522417174NAC domain-containing protein 19
3swp_B7e-556522417174NAC domain-containing protein 19
3swp_C7e-556522417174NAC domain-containing protein 19
3swp_D7e-556522417174NAC domain-containing protein 19
4dul_A7e-556522414171NAC domain-containing protein 19
4dul_B7e-556522414171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667450.0KC966745.1 Brassica napus NAC transcription factor 100 (NAC100.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013595819.10.0PREDICTED: NAC domain-containing protein 100
RefseqXP_013724255.10.0PREDICTED: NAC domain-containing protein 100
SwissprotQ9FLJ20.0NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A0D3DDL10.0A0A0D3DDL1_BRAOL; Uncharacterized protein
STRINGBra012960.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40028174
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.10.0NAC domain containing protein 100